PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1146s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 317aa    MW: 35875.3 Da    PI: 7.4988
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1146s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.66.7e-5551311129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+++yL++kv++ +++  +++ +vd++k+ePwdLp k++ +ekewyfFs rd+ky+tg r+nrat++gyWk+tg
  SapurV1A.1146s0010.1.p   5 LPPGFRFHPTDEELITCYLTRKVSDIRFTS-KAVVDVDLNKCEPWDLPGKASMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKTTG 90 
                             79*************************999.88***************988999********************************* PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             kd+e++s  g lvg+kktLvfy+grap+gek++Wvmheyrle
  SapurV1A.1146s0010.1.p  91 KDREIFS-AGVLVGMKKTLVFYRGRAPRGEKSNWVMHEYRLE 131
                             *******.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-643151IPR003441NAC domain
PROSITE profilePS5100560.0715151IPR003441NAC domain
PfamPF023652.5E-286130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEESLPPGFR FHPTDEELIT CYLTRKVSDI RFTSKAVVDV DLNKCEPWDL PGKASMGEKE  60
WYFFSLRDRK YPTGLRTNRA TEAGYWKTTG KDREIFSAGV LVGMKKTLVF YRGRAPRGEK  120
SNWVMHEYRL ENKHPFKNTK EEWVVCRIFQ KSDAVKKPQQ EPSSQQSLGS LCDTNSMVND  180
QFGDIEFPNL NRIANSSCGF SNILAHTYNN ENNVNMNLNM NWAAAREAAT LPSLSWPSGL  240
LSSNLTTNSL LLKALQLRSY QQREATTTDY SILTNGIAHE FGTDLGSNLQ ASSSSKILDP  300
APQPQQEQPF HLDSIW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-57415716171NO APICAL MERISTEM PROTEIN
1ut4_B5e-57415716171NO APICAL MERISTEM PROTEIN
1ut7_A5e-57415716171NO APICAL MERISTEM PROTEIN
1ut7_B5e-57415716171NO APICAL MERISTEM PROTEIN
4dul_A5e-57415716171NAC domain-containing protein 19
4dul_B5e-57415716171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011009316.10.0PREDICTED: NAC domain-containing protein 100-like
TrEMBLB9IE380.0B9IE38_POPTR; Uncharacterized protein
STRINGPOPTR_0015s03700.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49463356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-110NAC domain containing protein 58